PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 285aa    MW: 30923.4 Da    PI: 5.8383
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24482genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.72.7e-3353107155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Tp57577_TGAC_v2_mRNA24482  53 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 107
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0650110IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-3253108IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1753107IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-2653108IPR006447Myb domain, plants
PfamPF002491.5E-755106IPR001005SANT/Myb domain
PfamPF143796.8E-24140185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MYHAKKFPEA TMMPHKSQGG GAEQLANVGV LSGSAVKNVA PAPAPAPSGG GGKQRLRWTS  60
DLHDRFVDAI TQLGGPDRAT PKGVLRVMGV PGLTIYHVKS HLQKYRLAKY LPESPADDSK  120
DEKRNSGDSI SGADSSPGLQ INDALRMQME VQKRLHEQLE VQKQLQMRIE AQGKYLQKII  180
EEQQKLGGTL AASETLPLPH DKHNHTQSEP SGSSDALAGT FSPLKKQRID EGPKDGFTAS  240
QVTRESAEKN DCNVGRLDPN LYEDDDAGFG FDLETENDDN NESE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ0073111e-165HQ007311.1 Glycine max cultivar Jidou11 MYB transcription factor (PHR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493285.11e-178PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A151TAH91e-168A0A151TAH9_CAJCA; Myb family transcription factor APL
STRINGGLYMA19G30220.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-74G2-like family protein